PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00088.1.g02470.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 289aa    MW: 31385.5 Da    PI: 8.83
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00088.1.g02470.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.99.3e-28239289151
                         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                     k+r++W+peLH+rFv a+++LGG++ AtPk+i+elmkv+gLt+++vkSHLQ
  Zjn_sc00088.1.g02470.1.sm.mkhc 239 KARRCWSPELHRRFVAALQRLGGAQAATPKQIRELMKVDGLTNDEVKSHLQ 289
                                     68************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.556236289IPR017930Myb domain
SuperFamilySSF466898.6E-13237289IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-24237289IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-22239289IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGPAVRTDDV QALAARAVTD SLRAAAARSG VCEADRAARF EECVRDLEAE KAKMEVFRRE  60
LPISVHLVAD VIEWLKDELA QHRRPKASEL FAPVAVPAPA KRKVATEAED KRSWMSSAQL  120
WSCGSLDDSN GAKKPAHKNE NEFYRKSTTC SRDCIVYFPP CVANPRCRHL PTQVPNASMP  180
LNNGLQAASA RPTEAATPLP DLSLSSPATD GSCPAAPSAT SSAVTDAGAA QRQQQGQRKA  240
RRCWSPELHR RFVAALQRLG GAQAATPKQI RELMKVDGLT NDEVKSHLQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963026.13e-82PREDICTED: probable transcription factor GLK2 isoform X1
TrEMBLW5G1G02e-98W5G1G0_WHEAT; Uncharacterized protein
STRINGSi022287m1e-81(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55823353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.19e-21G2-like family protein